PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 260aa    MW: 28543.3 Da    PI: 8.042
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013610genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-43221221101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv++ yfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+ +k
  Lus10013610  22 PCAACKFLRRKCQPECVFSAYFPPDQPQKFANVHKVFGASNVTKLLNELHPSQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQLDLSCAK 119
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  ++l
  Lus10013610 120 SQL 122
                  875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.34121122IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-4322119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MSHNSLSTIS TTTSSTSSSS SPCAACKFLR RKCQPECVFS AYFPPDQPQK FANVHKVFGA  60
SNVTKLLNEL HPSQREDAVN SLAYEADMRL RDPVYGCVGV ISLLQHQLRQ LQLDLSCAKS  120
QLCRYHQSLG LPPVSGLVMA QQQQSPILLC RYHQSLGLPP VSGLVMAQQQ QSPILLAGGL  180
NNYSYLQHQH HQHQQQQQQM LMMMRGNNGN NNIVAGNGVY ESDLLAMNVM TAGGGTTSIG  240
HLSQFQQPDH DRHNSMEPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.15e-77PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.15e-77PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.15e-77PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.15e-77PREDICTED: LOB domain-containing protein 6
SwissprotO044799e-68LBD6_ARATH; LOB domain-containing protein 6
TrEMBLD7SSJ36e-77D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t012e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96253043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-60LBD family protein